Lineage for d5lf1f_ (5lf1 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2996355Species Human (Homo sapiens) [TaxId:9606] [311424] (13 PDB entries)
  8. 2996373Domain d5lf1f_: 5lf1 F: [321657]
    Other proteins in same PDB: d5lf1a_, d5lf1b_, d5lf1c_, d5lf1d_, d5lf1g_, d5lf1h_, d5lf1j_, d5lf1k_, d5lf1l_, d5lf1n_, d5lf1o_, d5lf1p_, d5lf1q_, d5lf1r_, d5lf1u_, d5lf1v_, d5lf1x_, d5lf1y_, d5lf1z_
    automated match to d4g4sg_
    complexed with 1pe, 6vc, cl, k, mg

Details for d5lf1f_

PDB Entry: 5lf1 (more details), 2 Å

PDB Description: human 20s proteasome complex with dihydroeponemycin at 2.0 angstrom
PDB Compounds: (F:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5lf1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lf1f_ d.153.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsnkr
lfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhaytly
savrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmkemt
crdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakeslk

SCOPe Domain Coordinates for d5lf1f_:

Click to download the PDB-style file with coordinates for d5lf1f_.
(The format of our PDB-style files is described here.)

Timeline for d5lf1f_: