Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome beta subunit (catalytic) [56252] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [311421] (15 PDB entries) |
Domain d5lf7n_: 5lf7 N: [321655] Other proteins in same PDB: d5lf7a_, d5lf7b_, d5lf7c_, d5lf7d_, d5lf7e_, d5lf7f_, d5lf7g_, d5lf7h_, d5lf7i_, d5lf7j_, d5lf7m_, d5lf7o_, d5lf7p_, d5lf7q_, d5lf7r_, d5lf7s_, d5lf7t_, d5lf7u_, d5lf7v_, d5lf7w_, d5lf7x_ automated match to d1iruh_ complexed with 1pe, 6v8, cl, k, mg |
PDB Entry: 5lf7 (more details), 2 Å
SCOPe Domain Sequences for d5lf7n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lf7n_ d.153.1.4 (N:) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]} ttimavqfdggvvlgadsrtttgsyianrvtdkltpihdrifccrsgsaadtqavadavt yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm vrqsfaiggsgssyiygyvdatyregmtkeeclqftanalalamerdgssggvirlaaia esgverqvllgdqipkfavatl
Timeline for d5lf7n_: