Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome beta subunit (catalytic) [56252] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [311421] (15 PDB entries) |
Domain d5lf3n1: 5lf3 N:2-202 [321624] Other proteins in same PDB: d5lf3a_, d5lf3b_, d5lf3c_, d5lf3d_, d5lf3e_, d5lf3f_, d5lf3g_, d5lf3h_, d5lf3i_, d5lf3j_, d5lf3m_, d5lf3n2, d5lf3o_, d5lf3p_, d5lf3q_, d5lf3r_, d5lf3s_, d5lf3t_, d5lf3u_, d5lf3v_, d5lf3w_, d5lf3x_ automated match to d1iruh_ complexed with 1pe, bo2, cl, k, mg |
PDB Entry: 5lf3 (more details), 2.1 Å
SCOPe Domain Sequences for d5lf3n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lf3n1 d.153.1.4 (N:2-202) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]} timavqfdggvvlgadsrtttgsyianrvtdkltpihdrifccrsgsaadtqavadavty qlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmmv rqsfaiggsgssyiygyvdatyregmtkeeclqftanalalamerdgssggvirlaaiae sgverqvllgdqipkfavatl
Timeline for d5lf3n1: