Lineage for d5lf3k_ (5lf3 K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2993109Species Human (Homo sapiens) [TaxId:9606] [311421] (15 PDB entries)
  8. 2993133Domain d5lf3k_: 5lf3 K: [321612]
    Other proteins in same PDB: d5lf3a_, d5lf3b_, d5lf3c_, d5lf3d_, d5lf3e_, d5lf3f_, d5lf3g_, d5lf3h_, d5lf3i_, d5lf3j_, d5lf3m_, d5lf3n2, d5lf3o_, d5lf3p_, d5lf3q_, d5lf3r_, d5lf3s_, d5lf3t_, d5lf3u_, d5lf3v_, d5lf3w_, d5lf3x_
    automated match to d1irul_
    complexed with 1pe, bo2, cl, k, mg

Details for d5lf3k_

PDB Entry: 5lf3 (more details), 2.1 Å

PDB Description: human 20s proteasome complex with bortezomib at 2.1 angstrom
PDB Compounds: (K:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d5lf3k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lf3k_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]}
tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
edgwirvssdnvadlhekys

SCOPe Domain Coordinates for d5lf3k_:

Click to download the PDB-style file with coordinates for d5lf3k_.
(The format of our PDB-style files is described here.)

Timeline for d5lf3k_: