Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species) contains an extension to the common fold at the N-terminus |
Species Human (Homo sapiens) [TaxId:9606] [311422] (15 PDB entries) |
Domain d5lf1a_: 5lf1 A: [321548] Other proteins in same PDB: d5lf1d_, d5lf1e_, d5lf1f_, d5lf1g_, d5lf1h_, d5lf1i_, d5lf1j_, d5lf1k_, d5lf1l_, d5lf1m_, d5lf1n_, d5lf1r_, d5lf1s_, d5lf1t_, d5lf1u_, d5lf1v_, d5lf1w_, d5lf1x_, d5lf1y_, d5lf1z_ automated match to d1irub_ complexed with 1pe, 6vc, cl, k, mg |
PDB Entry: 5lf1 (more details), 2 Å
SCOPe Domain Sequences for d5lf1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lf1a_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]} rgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvh kvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytq sggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedle ledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaai
Timeline for d5lf1a_: