Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311424] (13 PDB entries) |
Domain d5lf7e_: 5lf7 E: [321523] Other proteins in same PDB: d5lf7a_, d5lf7b_, d5lf7d_, d5lf7g_, d5lf7h_, d5lf7j_, d5lf7k_, d5lf7l_, d5lf7n_, d5lf7o_, d5lf7p_, d5lf7r_, d5lf7u_, d5lf7v_, d5lf7x_, d5lf7y_, d5lf7z_ automated match to d4g4se_ complexed with 1pe, 6v8, cl, k, mg |
PDB Entry: 5lf7 (more details), 2 Å
SCOPe Domain Sequences for d5lf7e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lf7e_ d.153.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry grrpygvglliagyddmgphifqtxpsanyfdcramsigarsqsartylerhmsefmecn lnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegle
Timeline for d5lf7e_: