Lineage for d1f5na2 (1f5n A:7-283)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69780Protein Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain [52639] (1 species)
  7. 69781Species Human (Homo sapiens) [TaxId:9606] [52640] (2 PDB entries)
  8. 69782Domain d1f5na2: 1f5n A:7-283 [32152]
    Other proteins in same PDB: d1f5na1

Details for d1f5na2

PDB Entry: 1f5n (more details), 1.7 Å

PDB Description: human guanylate binding protein-1 in complex with the gtp analogue, gmppnp.

SCOP Domain Sequences for d1f5na2:

Sequence, based on SEQRES records: (download)

>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens)}
mtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkgfs
lgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsstf
vynsigtinqqamdqlyyvtelthrirsksspdenenevedsadfvsffpdfvwtlrdfs
ldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrrk
laqleklqdeeldpefvqqvadfcsyifsnsktktls

Sequence, based on observed residues (ATOM records): (download)

>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens)}
mtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkgfs
lgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsstf
vynsigtinqqamdqlyyvtelthrirskssvedsadfvsffpdfvwtlrdfsldleadg
qpltpdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrrklaqlekl
qdeeldpefvqqvadfcsyifsnsktktls

SCOP Domain Coordinates for d1f5na2:

Click to download the PDB-style file with coordinates for d1f5na2.
(The format of our PDB-style files is described here.)

Timeline for d1f5na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f5na1