Lineage for d5ixja_ (5ixj A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2480954Protein automated matches [190054] (15 species)
    not a true protein
  7. 2480983Species Pyrococcus furiosus [TaxId:186497] [279274] (15 PDB entries)
  8. 2480984Domain d5ixja_: 5ixj A: [321510]
    Other proteins in same PDB: d5ixjb2, d5ixjd2
    automated match to d1v8zb_
    complexed with na, thr

Details for d5ixja_

PDB Entry: 5ixj (more details), 1.54 Å

PDB Description: tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site
PDB Compounds: (A:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5ixja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ixja_ c.79.1.1 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkv

SCOPe Domain Coordinates for d5ixja_:

Click to download the PDB-style file with coordinates for d5ixja_.
(The format of our PDB-style files is described here.)

Timeline for d5ixja_: