SCOP 1.71: Domain d1egaa1: 1ega A:4-182

Lineage for d1egaa1 (1ega A:4-182)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTPase Era, N-terminal domain [52637] (2 species)

7. Species Escherichia coli [TaxId:562] [52638] (1 PDB entry)

8. Domain d1egaa1: 1ega A:4-182 [32150]
   Other proteins in same PDB: d1egaa2, d1egab2

Details for d1egaa1

PDB Entry: 1ega, 2.4 Å

PDB Description: crystal structure of a widely conserved gtpase era

SCOP Domain Sequences for d1egaa1:

Sequence; same for both SEQRES and ATOM records:

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli}
dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe

Timeline for d1egaa1:

• d1egaa1 first appeared (with stable ids) in SCOP 1.55
  
• d1egaa1 appears in SCOP 1.69
  
• d1egaa1 appears in SCOP 1.73
  
• d1egaa1 appears in the current release, SCOPe 2.08