Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries) |
Domain d5lexg_: 5lex G: [321480] Other proteins in same PDB: d5lexa_, d5lexb_, d5lexc_, d5lexe_, d5lexf_, d5lexi_, d5lexk_, d5lexl_, d5lexm_, d5lexn_, d5lexo_, d5lexp_, d5lexq_, d5lexs_, d5lext_, d5lexw_, d5lexy_, d5lexz_ automated match to d1irua_ complexed with 1pe, k, mg |
PDB Entry: 5lex (more details), 2.2 Å
SCOPe Domain Sequences for d5lexg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lexg_ d.153.1.4 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdxavivtqkkvpdkll dsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi sqvytqnaemrplgccmiligideeqgpqvykcdpagyyxgfkataagvkqtestsflek kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva laer
Timeline for d5lexg_: