Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (31 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (1 species) has internal nucleotide exchange factor built in as an insertion subdomain |
Species Thermus thermophilus [TaxId:274] [52634] (5 PDB entries) residues 160-252 comprise insertion subdomain |
Domain d1efga2: 1efg A:1-282 [32146] Other proteins in same PDB: d1efga1, d1efga3, d1efga4 complexed with gdp |
PDB Entry: 1efg (more details), 2.7 Å
SCOP Domain Sequences for d1efga2:
Sequence, based on SEQRES records: (download)
>d1efga2 c.37.1.8 (A:1-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus} mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv lrmkaytygndlgtdireipipeeyldnareyheklvevaadfdenimlkylegeeptee elvaairkgtidlkitpvflgsalknkgvqllldavvdylps
>d1efga2 c.37.1.8 (A:1-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus} mavkveydlkrlrnigiaahidagktttterilyytgrihktaavttcfwkdhriniidt pghvdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktga dlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipee yldnareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsal knkgvqllldavvdylps
Timeline for d1efga2: