Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5jdjn_: 5jdj N: [321447] Other proteins in same PDB: d5jdja2, d5jdjb2, d5jdjc2, d5jdjd2, d5jdje2, d5jdjf2, d5jdjg2, d5jdjh2, d5jdji2, d5jdjk2, d5jdjl2 automated match to d1waae_ complexed with ca |
PDB Entry: 5jdj (more details), 1.74 Å
SCOPe Domain Sequences for d5jdjn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jdjn_ b.1.1.0 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]} etlhitktmknievpetktasfecevshfnvpsmwlkngveiemsekfkivvqgklhqli imntstedsaeytfvcgndqvsatlt
Timeline for d5jdjn_:
View in 3D Domains from other chains: (mouse over for more information) d5jdja1, d5jdja2, d5jdjb1, d5jdjb2, d5jdjc1, d5jdjc2, d5jdjd1, d5jdjd2, d5jdje1, d5jdje2, d5jdjf1, d5jdjf2, d5jdjg1, d5jdjg2, d5jdjh1, d5jdjh2, d5jdji1, d5jdji2, d5jdjj_, d5jdjk1, d5jdjk2, d5jdjl1, d5jdjl2, d5jdjm_, d5jdjo_, d5jdjp_ |