![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (31 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (1 species) has internal nucleotide exchange factor built in as an insertion subdomain |
![]() | Species Thermus thermophilus [TaxId:274] [52634] (5 PDB entries) residues 160-252 comprise insertion subdomain |
![]() | Domain d1fnma2: 1fnm A:6-282 [32144] Other proteins in same PDB: d1fnma1, d1fnma3, d1fnma4, d1fnma5 complexed with gdp, mg; mutant |
PDB Entry: 1fnm (more details), 2.8 Å
SCOP Domain Sequences for d1fnma2:
Sequence, based on SEQRES records: (download)
>d1fnma2 c.37.1.8 (A:6-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus} eydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergiti taavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwrqa ekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmka ytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelvaa irkgtidlkitpvflgsalknkgvqllldavvdylps
>d1fnma2 c.37.1.8 (A:6-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus} eydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdftie versmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirtm qerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqareyh eklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqlll davvdylps
Timeline for d1fnma2:
![]() Domains from same chain: (mouse over for more information) d1fnma1, d1fnma3, d1fnma4, d1fnma5 |