Lineage for d2efga2 (2efg A:7-282)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122005Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (1 species)
  7. 122006Species Thermus thermophilus [TaxId:274] [52634] (5 PDB entries)
  8. 122008Domain d2efga2: 2efg A:7-282 [32143]
    Other proteins in same PDB: d2efga1, d2efga3, d2efga4

Details for d2efga2

PDB Entry: 2efg (more details), 2.6 Å

PDB Description: translational elongation factor g complexed with gdp

SCOP Domain Sequences for d2efga2:

Sequence, based on SEQRES records: (download)

>d2efga2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus}
ydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergitit
aavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwrqae
kykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkay
tygndlgtdireipipeeyldnareyheklvevaadfdenimlkylegeepteeelvaai
rkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records): (download)

>d2efga2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus}
ydlkrlrnigiaahidagktttterilyytgriaavttcfwkdhriniidtpghvdftie
versmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirtm
qerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldnareyh
eklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqlll
davvdylps

SCOP Domain Coordinates for d2efga2:

Click to download the PDB-style file with coordinates for d2efga2.
(The format of our PDB-style files is described here.)

Timeline for d2efga2: