Lineage for d1dara2 (1dar A:1-282)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846259Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (2 species)
    has internal nucleotide exchange factor built in as an insertion subdomain
  7. 1846260Species Thermus thermophilus [TaxId:274] [52634] (9 PDB entries)
    residues 160-252 comprise insertion subdomain
  8. 1846263Domain d1dara2: 1dar A:1-282 [32142]
    Other proteins in same PDB: d1dara1, d1dara3, d1dara4
    complexed with gdp

Details for d1dara2

PDB Entry: 1dar (more details), 2.4 Å

PDB Description: elongation factor g in complex with gdp
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1dara2:

Sequence, based on SEQRES records: (download)

>d1dara2 c.37.1.8 (A:1-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
elvaairkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records): (download)

>d1dara2 c.37.1.8 (A:1-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
mavkveydlkrlrnigiaahidagktttterilyytgriaavttcfwkdhriniidtpgh
vdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlw
lvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyld
qareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknk
gvqllldavvdylps

SCOPe Domain Coordinates for d1dara2:

Click to download the PDB-style file with coordinates for d1dara2.
(The format of our PDB-style files is described here.)

Timeline for d1dara2: