SCOP 1.69: Domain d1g7ca3: 1g7c A:4-240

Lineage for d1g7ca3 (1g7c A:4-240)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (43 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52632] (4 PDB entries)

8. Domain d1g7ca3: 1g7c A:4-240 [32141]
   Other proteins in same PDB: d1g7ca1, d1g7ca2, d1g7cb_

Details for d1g7ca3

PDB Entry: 1g7c, 2.05 Å

PDB Description: yeast eef1a:eef1ba in complex with gdpnp

SCOP Domain Sequences for d1g7ca3:

Sequence; same for both SEQRES and ATOM records:

>d1g7ca3 c.37.1.8 (A:4-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae)}
ekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvldkl
kaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvgef
eagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgynp
ktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt

Timeline for d1g7ca3:

• d1g7ca3 first appeared (with stable ids) in SCOP 1.55
  
• d1g7ca3 appears in SCOP 1.67
  
• d1g7ca3 appears in SCOP 1.71
  
• d1g7ca3 appears in the current release, SCOPe 2.08