Lineage for d5jdjb1 (5jdj B:4-91)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755026Domain d5jdjb1: 5jdj B:4-91 [321400]
    Other proteins in same PDB: d5jdja2, d5jdjb2, d5jdjc2, d5jdjd2, d5jdje2, d5jdjf2, d5jdjg2, d5jdjh2, d5jdji2, d5jdjk2, d5jdjl2
    automated match to d1waae_
    complexed with ca

Details for d5jdjb1

PDB Entry: 5jdj (more details), 1.74 Å

PDB Description: crystal structure of domain i10 from titin in space group p212121
PDB Compounds: (B:) titin

SCOPe Domain Sequences for d5jdjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jdjb1 b.1.1.0 (B:4-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etlhitktmknievpetktasfecevshfnvpsmwlkngveiemsekfkivvqgklhqli
imntstedsaeytfvcgndqvsatltvt

SCOPe Domain Coordinates for d5jdjb1:

Click to download the PDB-style file with coordinates for d5jdjb1.
(The format of our PDB-style files is described here.)

Timeline for d5jdjb1: