SCOPe 2.08: Domain d5j7cd1: 5j7c D:2-94

Lineage for d5j7cd1 (5j7c D:2-94)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d5j7cd1: 5j7c D:2-94 [321393]
   Other proteins in same PDB: d5j7ca_, d5j7cb_, d5j7cc2, d5j7cd2
   automated match to d5a41g_

Details for d5j7cd1

PDB Entry: 5j7c, 2.54 Å

PDB Description: a picomolar affinity fn3 domain in complex with hen egg-white lysozyme

PDB Compounds: (D:) FNfn10-anti-lysozyme (DE0.4.1)

SCOPe Domain Sequences for d5j7cd1:

Sequence; same for both SEQRES and ATOM records:

>d5j7cd1 b.1.2.0 (D:2-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsdvprdlevvaatptslliswrgypwatyygiiygetggnslvqeftmpgdlshratis
glkpgvdytitvyavtrvgrtfdtpgpisinyr

Timeline for d5j7cd1:

• d5j7cd1 first appeared in SCOPe 2.06
  
• d5j7cd1 appears in SCOPe 2.07