| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
| Species Cow (Bos taurus), mitochondrial [TaxId:9913] [52630] (2 PDB entries) |
| Domain d1d2ea3: 1d2e A:55-250 [32136] Other proteins in same PDB: d1d2ea1, d1d2ea2, d1d2eb1, d1d2eb2, d1d2ec1, d1d2ec2, d1d2ed1, d1d2ed2 |
PDB Entry: 1d2e (more details), 1.94 Å
SCOP Domain Sequences for d1d2ea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial}
kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
svqklldavdtyipvp
Timeline for d1d2ea3: