Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
Species Thermus thermophilus [TaxId:274] [52629] (7 PDB entries) |
Domain d1aipf3: 1aip F:9-212 [32135] Other proteins in same PDB: d1aipa1, d1aipa2, d1aipb1, d1aipb2, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe2, d1aipf1, d1aipf2, d1aipg1, d1aipg2, d1aiph1, d1aiph2 |
PDB Entry: 1aip (more details), 3 Å
SCOP Domain Sequences for d1aipf3:
Sequence, based on SEQRES records: (download)
>d1aipf3 c.37.1.8 (F:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt rrgenewvdkiwelldaideyipt
>d1aipf3 c.37.1.8 (F:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} kphvnvgtighvdhgkttltaaltyvtaaenpahveyetakrhyshvdcpghadyiknmi tgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlveme vrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt
Timeline for d1aipf3: