Lineage for d5ircf_ (5irc F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125077Protein RhoA [52612] (1 species)
  7. 2125078Species Human (Homo sapiens) [TaxId:9606] [52613] (26 PDB entries)
    Uniprot P61586 2-181
  8. 2125091Domain d5ircf_: 5irc F: [321342]
    Other proteins in same PDB: d5irca1, d5irca2, d5ircb_
    automated match to d1cxza_
    complexed with cl, gdp, mg, mgf

Details for d5ircf_

PDB Entry: 5irc (more details), 1.72 Å

PDB Description: p190a gap domain complex with rhoa
PDB Compounds: (F:) transforming protein rhoa

SCOPe Domain Sequences for d5ircf_:

Sequence, based on SEQRES records: (download)

>d5ircf_ c.37.1.8 (F:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

Sequence, based on observed residues (ATOM records): (download)

>d5ircf_ c.37.1.8 (F:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgacgktcllivnvyvptvfenyvadievdgkqvelalwdtagqedydrlr
plsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrndehtrre
lakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

SCOPe Domain Coordinates for d5ircf_:

Click to download the PDB-style file with coordinates for d5ircf_.
(The format of our PDB-style files is described here.)

Timeline for d5ircf_: