Lineage for d1aipb3 (1aip B:9-212)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122012Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 122038Species Thermus thermophilus [TaxId:274] [52629] (3 PDB entries)
  8. 122043Domain d1aipb3: 1aip B:9-212 [32133]
    Other proteins in same PDB: d1aipa1, d1aipa2, d1aipb1, d1aipb2, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe2, d1aipf1, d1aipf2, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipb3

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipb3:

Sequence, based on SEQRES records: (download)

>d1aipb3 c.37.1.8 (B:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus}
kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
rrgenewvdkiwelldaideyipt

Sequence, based on observed residues (ATOM records): (download)

>d1aipb3 c.37.1.8 (B:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus}
kphvnvgtighvdhgkttltaaltyvtaaenptahveyetakrhyshvdcpghadyiknm
itgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlvem
evrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d1aipb3:

Click to download the PDB-style file with coordinates for d1aipb3.
(The format of our PDB-style files is described here.)

Timeline for d1aipb3: