SCOP 1.57: Domain d1aipb3: 1aip B:9-212

Lineage for d1aipb3 (1aip B:9-212)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.8: G proteins [52592] (20 proteins)

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Thermus thermophilus [TaxId:274] [52629] (3 PDB entries)

8. Domain d1aipb3: 1aip B:9-212 [32133]
   Other proteins in same PDB: d1aipa1, d1aipa2, d1aipb1, d1aipb2, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe2, d1aipf1, d1aipf2, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipb3

PDB Entry: 1aip, 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipb3:

Sequence, based on SEQRES records:

>d1aipb3 c.37.1.8 (B:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus}
kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
rrgenewvdkiwelldaideyipt

Sequence, based on observed residues (ATOM records):

>d1aipb3 c.37.1.8 (B:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus}
kphvnvgtighvdhgkttltaaltyvtaaenptahveyetakrhyshvdcpghadyiknm
itgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpelldlvem
evrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldaideyipt

Timeline for d1aipb3:

• d1aipb3 first appeared (with stable ids) in SCOP 1.55
  
• d1aipb3 appears in SCOP 1.59
  
• d1aipb3 appears in the current release, SCOPe 2.08