Lineage for d1exma3 (1exm A:3-212)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846288Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 1846321Species Thermus thermophilus [TaxId:274] [52629] (4 PDB entries)
  8. 1846322Domain d1exma3: 1exm A:3-212 [32131]
    Other proteins in same PDB: d1exma1, d1exma2
    protein/RNA complex; complexed with gnp, mg

Details for d1exma3

PDB Entry: 1exm (more details), 1.7 Å

PDB Description: crystal structure of thermus thermophilus elongation factor tu (ef-tu) in complex with the gtp analogue gppnhp.
PDB Compounds: (A:) elongation factor tu (ef-tu)

SCOPe Domain Sequences for d1exma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exma3 c.37.1.8 (A:3-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerargit
intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
hrnpktrrgenewvdkiwelldaideyipt

SCOPe Domain Coordinates for d1exma3:

Click to download the PDB-style file with coordinates for d1exma3.
(The format of our PDB-style files is described here.)

Timeline for d1exma3: