Lineage for d5hs9a_ (5hs9 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (78 species)
    not a true protein
  7. 2307198Species Bacillus subtilis [TaxId:224308] [321300] (3 PDB entries)
  8. 2307202Domain d5hs9a_: 5hs9 A: [321304]
    automated match to d4hqmb_

Details for d5hs9a_

PDB Entry: 5hs9 (more details), 2.1 Å

PDB Description: crystal structure of the quinone-bound yodb from b. subtilis
PDB Compounds: (A:) HTH-type transcriptional regulator YodB

SCOPe Domain Sequences for d5hs9a_:

Sequence, based on SEQRES records: (download)

>d5hs9a_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
cpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqneiver
qvlpetpvkviytltekgtalqavfqemqawadqf

Sequence, based on observed residues (ATOM records): (download)

>d5hs9a_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
cpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqneiver
qvviytltekgtalqavfqemqawadqf

SCOPe Domain Coordinates for d5hs9a_:

Click to download the PDB-style file with coordinates for d5hs9a_.
(The format of our PDB-style files is described here.)

Timeline for d5hs9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5hs9b_