Lineage for d5d78a1 (5d78 A:313-387)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2519561Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2519562Protein automated matches [190896] (11 species)
    not a true protein
  7. 2519580Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries)
  8. 2519581Domain d5d78a1: 5d78 A:313-387 [321293]
    Other proteins in same PDB: d5d78a2
    automated match to d2sxla_
    complexed with bme, so4

Details for d5d78a1

PDB Entry: 5d78 (more details), 1.25 Å

PDB Description: structure of rrm3 domain of mip6 at 1.25 a resolution
PDB Compounds: (A:) RNA-binding protein MIP6

SCOPe Domain Sequences for d5d78a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d78a1 d.58.7.0 (A:313-387) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ktilvknlpsdttqeevldyfstigpiksvfisekqantphkafvtykneeeskkaqkcl
nktifknhtiwvgpg

SCOPe Domain Coordinates for d5d78a1:

Click to download the PDB-style file with coordinates for d5d78a1.
(The format of our PDB-style files is described here.)

Timeline for d5d78a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d78a2