SCOPe 2.08: Domain d5fa6b3: 5fa6 B:522-680

Lineage for d5fa6b3 (5fa6 B:522-680)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226188] (8 PDB entries)

8. Domain d5fa6b3: 5fa6 B:522-680 [321292]
   Other proteins in same PDB: d5fa6a1, d5fa6a2, d5fa6b1, d5fa6b2
   automated match to d1j9za3
   complexed with fad, fmn, nap

Details for d5fa6b3

PDB Entry: 5fa6, 2.3 Å

PDB Description: wild type human cypor

PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d5fa6b3:

Sequence; same for both SEQRES and ATOM records:

>d5fa6b3 c.25.1.0 (B:522-680) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyree
laqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieggahiyvcgdarnmard
vqntfydivaelgamehaqavdyikklmtkgrysldvws

Timeline for d5fa6b3:

• d5fa6b3 first appeared in SCOPe 2.06
  
• d5fa6b3 appears in SCOPe 2.07