Lineage for d1tttc3 (1ttt C:1-212)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122012Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 122029Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries)
  8. 122034Domain d1tttc3: 1ttt C:1-212 [32127]
    Other proteins in same PDB: d1ttta1, d1ttta2, d1tttb1, d1tttb2, d1tttc1, d1tttc2

Details for d1tttc3

PDB Entry: 1ttt (more details), 2.7 Å

PDB Description: phe-trna, elongation factor ef-tu:gdpnp ternary complex

SCOP Domain Sequences for d1tttc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tttc3 c.37.1.8 (C:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus}
akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d1tttc3:

Click to download the PDB-style file with coordinates for d1tttc3.
(The format of our PDB-style files is described here.)

Timeline for d1tttc3: