SCOPe 2.08: Domain d5fa6a1: 5fa6 A:70-242

Lineage for d5fa6a1 (5fa6 A:70-242)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226640] (7 PDB entries)

8. Domain d5fa6a1: 5fa6 A:70-242 [321266]
   Other proteins in same PDB: d5fa6a2, d5fa6a3, d5fa6b2, d5fa6b3
   automated match to d1ja1a2
   complexed with fad, fmn, nap

Details for d5fa6a1

PDB Entry: 5fa6, 2.3 Å

PDB Description: wild type human cypor

PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d5fa6a1:

Sequence; same for both SEQRES and ATOM records:

>d5fa6a1 c.23.5.0 (A:70-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk
yvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfgveatgee

Timeline for d5fa6a1:

• d5fa6a1 first appeared in SCOPe 2.06
  
• d5fa6a1 appears in SCOPe 2.07