Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries) |
Domain d1tttb3: 1ttt B:1-212 [32126] Other proteins in same PDB: d1ttta1, d1ttta2, d1tttb1, d1tttb2, d1tttc1, d1tttc2 protein/RNA complex; complexed with gnp, mg, phe |
PDB Entry: 1ttt (more details), 2.7 Å
SCOPe Domain Sequences for d1tttb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tttb3 c.37.1.8 (B:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus [TaxId: 271]} akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale emhknpktkrgenewvdkiwelldaideyipt
Timeline for d1tttb3: