Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) |
Family c.37.1.8: G proteins [52592] (20 proteins) |
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries) |
Domain d1b23p3: 1b23 P:1-212 [32124] Other proteins in same PDB: d1b23p1, d1b23p2 |
PDB Entry: 1b23 (more details), 2.6 Å
SCOP Domain Sequences for d1b23p3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b23p3 c.37.1.8 (P:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus} akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale emhknpktkrgenewvdkiwelldaideyipt
Timeline for d1b23p3: