Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
Species Thermus aquaticus [TaxId:271] [52628] (5 PDB entries) |
Domain d1efta3: 1eft A:1-212 [32123] Other proteins in same PDB: d1efta1, d1efta2 complexed with gnp, mg |
PDB Entry: 1eft (more details), 2.5 Å
SCOPe Domain Sequences for d1efta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efta3 c.37.1.8 (A:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus [TaxId: 271]} akgefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerarg itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale emhknpktkrgenewvdkiwelldaideyipt
Timeline for d1efta3: