SCOP 1.71: Domain d1eft_3: 1eft 1-212

Lineage for d1eft_3 (1eft 1-212)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries)

8. Domain d1eft_3: 1eft 1-212 [32123]
   Other proteins in same PDB: d1eft_1, d1eft_2
   complexed with gnp, mg

Details for d1eft_3

PDB Entry: 1eft, 2.5 Å

PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation

SCOP Domain Sequences for d1eft_3:

Sequence; same for both SEQRES and ATOM records:

>d1eft_3 c.37.1.8 (1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus}
akgefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt

Timeline for d1eft_3:

• d1eft_3 first appeared (with stable ids) in SCOP 1.55
  
• d1eft_3 appears in SCOP 1.69
  
• d1eft_3 is called d1efta3 in SCOP 1.73
  
• d1eft_3 appears in the current release, SCOPe 2.08, called d1efta3