| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
| Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries) |
| Domain d1eft_3: 1eft 1-212 [32123] Other proteins in same PDB: d1eft_1, d1eft_2 complexed with gnp, mg |
PDB Entry: 1eft (more details), 2.5 Å
SCOP Domain Sequences for d1eft_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eft_3 c.37.1.8 (1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus}
akgefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt
Timeline for d1eft_3: