Lineage for d1eft_3 (1eft 1-212)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) 
Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries) 
Domain d1eft_3: 1eft 1-212 [32123]
Other proteins in same PDB: d1eft_1, d1eft_2
Details for d1eft_3
PDB Entry: 1eft (more details), 2.5 Å
PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation
SCOP Domain Sequences for d1eft_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eft_3 c.37.1.8 (1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus}
akgefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt
SCOP Domain Coordinates for d1eft_3:
Click to download the PDB-style file with coordinates for d1eft_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eft_3:
- d1eft_3 first appeared (with stable ids) in SCOP 1.55
- d1eft_3 appears in SCOP 1.59
- d1eft_3 appears in the current release, SCOPe 2.08, called d1efta3
View in 3D
