Lineage for d1eft_3 (1eft 1-212)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23203Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 23220Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries)
  8. 23222Domain d1eft_3: 1eft 1-212 [32123]
    Other proteins in same PDB: d1eft_1, d1eft_2

Details for d1eft_3

PDB Entry: 1eft (more details), 2.5 Å

PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation

SCOP Domain Sequences for d1eft_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eft_3 c.37.1.8 (1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus}
akgefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d1eft_3:

Click to download the PDB-style file with coordinates for d1eft_3.
(The format of our PDB-style files is described here.)

Timeline for d1eft_3: