Lineage for d5dafa_ (5daf A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513558Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2513559Protein automated matches [190710] (4 species)
    not a true protein
  7. 2513560Species Human (Homo sapiens) [TaxId:9606] [187857] (47 PDB entries)
  8. 2513626Domain d5dafa_: 5daf A: [321228]
    automated match to d4cxta_
    complexed with 58e

Details for d5dafa_

PDB Entry: 5daf (more details), 2.37 Å

PDB Description: crystal structure of human keap1 btb domain in complex with small molecule tx64063
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d5dafa_:

Sequence, based on SEQRES records: (download)

>d5dafa_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfka
mftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvvr
acsdflvq

Sequence, based on observed residues (ATOM records): (download)

>d5dafa_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfka
mftmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvvracsdflv
q

SCOPe Domain Coordinates for d5dafa_:

Click to download the PDB-style file with coordinates for d5dafa_.
(The format of our PDB-style files is described here.)

Timeline for d5dafa_: