Lineage for d1efm__ (1efm -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23203Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 23209Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)
  8. 23219Domain d1efm__: 1efm - [32122]

Details for d1efm__

PDB Entry: 1efm (more details), 2.7 Å

PDB Description: structure of the gdp domain of ef-tu and location of the amino acids homologous to ras oncogene proteins

SCOP Domain Sequences for d1efm__:

Sequence, based on SEQRES records: (download)

>d1efm__ c.37.1.8 (-) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
vnvgtighvdhgkttltaaittvlaktyggaarxxxxxxxxxxxxxxgitintshveydt
ptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyii
vflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakile

Sequence, based on observed residues (ATOM records): (download)

>d1efm__ c.37.1.8 (-) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
vnvgtighvdhgkttltaaittvlaktytintshveydtptrhyahvdcpghadyvknmi
tgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelveme
vrellsqydfpgddtpivrgsalkalegdaeweakile

SCOP Domain Coordinates for d1efm__:

Click to download the PDB-style file with coordinates for d1efm__.
(The format of our PDB-style files is described here.)

Timeline for d1efm__: