Lineage for d5kvab_ (5kva B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.1: COMT-like [53336] (4 proteins) 
Protein automated matches [190251] (6 species)
not a true protein
Species Sorghum (Sorghum bicolor) [TaxId:4558] [321178] (1 PDB entry) 
Domain d5kvab_: 5kva B: [321217]
automated match to d1susa_
complexed with ca, sam
Details for d5kvab_
PDB Entry: 5kva (more details), 1.83 Å
PDB Description: crystal structure of sorghum caffeoyl-coa o-methyltransferase (ccoaomt)
PDB Compounds: (B:) Caffeoyl-CoA O-methyltransferaseSCOPe Domain Sequences for d5kvab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kvab_ c.66.1.1 (B:) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]}
hksllksddlyqyildtsvyprepesmkelreitakhpwnlmttsadegqflnmliklig
akktmeigvytgysllatalalpedgtilamdinrenyelglpciekagvahkidfregp
alpvlddliadeknhgsfdfvfvdadkdnylnyhdrllklvklggligydntlwngsvvl
pddapmrkyirfyrdfvlvlnkalaaderveicqlpvgdgvtlcrrvk
SCOPe Domain Coordinates for d5kvab_:
Click to download the PDB-style file with coordinates for d5kvab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5kvab_:
- d5kvab_ first appeared in SCOPe 2.06
- d5kvab_ appears in SCOPe 2.07
View in 3D
