Lineage for d1etu__ (1etu -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23203Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 23209Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)
  8. 23218Domain d1etu__: 1etu - [32121]

Details for d1etu__

PDB Entry: 1etu (more details), 2.9 Å

PDB Description: structural details of the binding of guanosine diphosphate to elongation factor tu from e. coli as studied by x-ray crystallography

SCOP Domain Sequences for d1etu__:

Sequence, based on SEQRES records: (download)

>d1etu__ c.37.1.8 (-) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
fertkphvnvgtighvdhgkttltaaittvlaktyggaaxxxxxxxxxxxxxxxgitint
shveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrq
vgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaew
eakilelagfldsyip

Sequence, based on observed residues (ATOM records): (download)

>d1etu__ c.37.1.8 (-) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
fertkphvnvgtighvdhgkttltaaittvlaktygitintshveydtptrhyahvdcpg
hadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvdde
ellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyip

SCOP Domain Coordinates for d1etu__:

Click to download the PDB-style file with coordinates for d1etu__.
(The format of our PDB-style files is described here.)

Timeline for d1etu__: