Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) |
Family d.50.1.3: The homologous-pairing domain of Rad52 recombinase [82645] (1 protein) contains N- and C-terminal extensions to the common fold involved in the oligomerization |
Protein The homologous-pairing domain of Rad52 recombinase [82646] (1 species) forms an undecameric ring structure; binds to ssDNA and dsDNA |
Species Human (Homo sapiens) [TaxId:9606] [82647] (3 PDB entries) |
Domain d5jrbe_: 5jrb E: [321202] automated match to d1h2ia_ mutant |
PDB Entry: 5jrb (more details), 2.41 Å
SCOPe Domain Sequences for d5jrbe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jrbe_ d.50.1.3 (E:) The homologous-pairing domain of Rad52 recombinase {Human (Homo sapiens) [TaxId: 9606]} cfgqcqytaeeyqaiqkalrqrlgpeyissrmagggqkvcyieghrvinlanemfgyngw ahsitqqnvdfvdlnngafyvgvcafvrvqlkdgsyhedvgygvseglaskalslekark eavtdglkralrsfgnalgncildkdylrslnklprqlplevdltkakrqdlepsveaar ynsc
Timeline for d5jrbe_: