Lineage for d1d8tb3 (1d8t B:9-204)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23203Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 23209Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)
  8. 23213Domain d1d8tb3: 1d8t B:9-204 [32120]
    Other proteins in same PDB: d1d8ta1, d1d8ta2, d1d8tb1, d1d8tb2

Details for d1d8tb3

PDB Entry: 1d8t (more details), 2.35 Å

PDB Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic

SCOP Domain Sequences for d1d8tb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8tb3 c.37.1.8 (B:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper

SCOP Domain Coordinates for d1d8tb3:

Click to download the PDB-style file with coordinates for d1d8tb3.
(The format of our PDB-style files is described here.)

Timeline for d1d8tb3: