| Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
| Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) ![]() |
| Family c.37.1.8: G proteins [52592] (20 proteins) |
| Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
| Species Escherichia coli [TaxId:562] [52627] (6 PDB entries) |
| Domain d1d8tb3: 1d8t B:9-204 [32120] Other proteins in same PDB: d1d8ta1, d1d8ta2, d1d8tb1, d1d8tb2 |
PDB Entry: 1d8t (more details), 2.35 Å
SCOP Domain Sequences for d1d8tb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8tb3 c.37.1.8 (B:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve
ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp
yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki
lelagfldsyipeper
Timeline for d1d8tb3: