Lineage for d5kvel_ (5kve L:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034695Domain d5kvel_: 5kve L: [321192]
    Other proteins in same PDB: d5kvee_, d5kveh_
    automated match to d4lrnl_
    complexed with act, edo, na, so4

Details for d5kvel_

PDB Entry: 5kve (more details), 1.7 Å

PDB Description: zika specific antibody, zv-48, bound to zika envelope diii
PDB Compounds: (L:) ZV-48 Antibody scFv Light Chain

SCOPe Domain Sequences for d5kvel_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvel_ b.1.1.0 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdivmsqspsslavsvgekitmsckssqsllysnneknylawyqqkpgqspklliywasa
rdsgvpdrftgsgsgtdftltissvkaedlavfycqqyysypytfgggtkleikg

SCOPe Domain Coordinates for d5kvel_:

Click to download the PDB-style file with coordinates for d5kvel_.
(The format of our PDB-style files is described here.)

Timeline for d5kvel_: