Lineage for d1d8ta3 (1d8t A:3-204)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69737Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 69743Species Escherichia coli [TaxId:562] [52627] (6 PDB entries)
  8. 69746Domain d1d8ta3: 1d8t A:3-204 [32119]
    Other proteins in same PDB: d1d8ta1, d1d8ta2, d1d8tb1, d1d8tb2

Details for d1d8ta3

PDB Entry: 1d8t (more details), 2.35 Å

PDB Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic

SCOP Domain Sequences for d1d8ta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ta3 c.37.1.8 (A:3-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli}
ekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargiti
ntshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillg
rqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegda
eweakilelagfldsyipeper

SCOP Domain Coordinates for d1d8ta3:

Click to download the PDB-style file with coordinates for d1d8ta3.
(The format of our PDB-style files is described here.)

Timeline for d1d8ta3: