Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
Species Escherichia coli [TaxId:562] [52627] (10 PDB entries) Uniprot P02990 |
Domain d1dg1h3: 1dg1 H:9-204 [32118] Other proteins in same PDB: d1dg1g1, d1dg1g2, d1dg1h1, d1dg1h2 complexed with gdp, mg |
PDB Entry: 1dg1 (more details), 2.5 Å
SCOPe Domain Sequences for d1dg1h3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dg1h3 c.37.1.8 (H:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]} kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki lelagfldsyipeper
Timeline for d1dg1h3: