![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) ![]() |
![]() | Family c.37.1.8: G proteins [52592] (20 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [52627] (6 PDB entries) |
![]() | Domain d1dg1h3: 1dg1 H:9-204 [32118] Other proteins in same PDB: d1dg1g1, d1dg1g2, d1dg1h1, d1dg1h2 |
PDB Entry: 1dg1 (more details), 2.5 Å
SCOP Domain Sequences for d1dg1h3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dg1h3 c.37.1.8 (H:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli} kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki lelagfldsyipeper
Timeline for d1dg1h3: