SCOPe 2.08: Domain d5jxef2: 5jxe F:111-215

Lineage for d5jxef2 (5jxe F:111-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5jxef2: 5jxe F:111-215 [321174]
   Other proteins in same PDB: d5jxea_, d5jxeb_, d5jxec1, d5jxef1
   automated match to d1dn0a2

Details for d5jxef2

PDB Entry: 5jxe, 2.9 Å

PDB Description: human pd-1 ectodomain complexed with pembrolizumab fab

PDB Compounds: (F:) Pembrolizumab Fab light chain

SCOPe Domain Sequences for d5jxef2:

Sequence; same for both SEQRES and ATOM records:

>d5jxef2 b.1.1.2 (F:111-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5jxef2:

• d5jxef2 first appeared in SCOPe 2.06
  
• d5jxef2 appears in SCOPe 2.07