Lineage for d5kzmb_ (5kzm B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2480954Protein automated matches [190054] (15 species)
    not a true protein
  7. 2480975Species Francisella tularensis [TaxId:177416] [321163] (1 PDB entry)
  8. 2480976Domain d5kzmb_: 5kzm B: [321164]
    Other proteins in same PDB: d5kzma_
    automated match to d2dh5a_
    complexed with act, ca

Details for d5kzmb_

PDB Entry: 5kzm (more details), 2.8 Å

PDB Description: crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d5kzmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kzmb_ c.79.1.1 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
msklnayfgeyggqfvpqilvpaldqleqefikaqadesfkqefkellqeyagrptaltk
trnivkntrtklylkredllhggahktnqvlgqallakrmgkkeiiaetgagqhgvatal
acalldlkcrvymgakdverqspnvfrmklmgaevipvhsgsatlkdacnealrdwsany
skahyllgtaagphpfptivrefqrmigeetkqqmlakegrlpdaviacvgggsnaigmf
adfideknvkligvepagkgietgehgaplkhgktgiffgmkaplmqnsdgqieesysis
agldfpsvgpqhahllaigrakyasatddealdafkllckkegiipalesshalahalkl
ayedpnkeqllvvnlsgrgdkdiftvhdilkekge

SCOPe Domain Coordinates for d5kzmb_:

Click to download the PDB-style file with coordinates for d5kzmb_.
(The format of our PDB-style files is described here.)

Timeline for d5kzmb_: