SCOPe 2.08: Domain d5k59l2: 5k59 L:107-212

Lineage for d5k59l2 (5k59 L:107-212)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d5k59l2: 5k59 L:107-212 [321144]
Other proteins in same PDB: d5k59a_, d5k59b_, d5k59c_, d5k59d_, d5k59e_, d5k59f1, d5k59h_, d5k59l1
automated match to d1dn0a2
complexed with cl, pg4, po4

Details for d5k59l2

PDB Entry: 5k59 (more details), 2.84 Å

PDB Description: crystal structure of lukgh from staphylococcus aureus in complex with a neutralising antibody

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d5k59l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k59l2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d5k59l2:

Click to download the PDB-style file with coordinates for d5k59l2.
(The format of our PDB-style files is described here.)

Timeline for d5k59l2: