Lineage for d5kveh_ (5kve H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2024789Domain d5kveh_: 5kve H: [321134]
    Other proteins in same PDB: d5kvee_, d5kvel_
    automated match to d1a6wh_
    complexed with act, edo, na, so4

Details for d5kveh_

PDB Entry: 5kve (more details), 1.7 Å

PDB Description: zika specific antibody, zv-48, bound to zika envelope diii
PDB Compounds: (H:) ZV-48 Antibody scFv Heavy chain

SCOPe Domain Sequences for d5kveh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kveh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqqpgaellkpgasvklsckasgysfsnywmhwvkqrpgqgpewigmihpnsgntky
nekfknkatltvdksssmvymqlssltsedsavfycarlgndmdywgqgtsvtvs

SCOPe Domain Coordinates for d5kveh_:

Click to download the PDB-style file with coordinates for d5kveh_.
(The format of our PDB-style files is described here.)

Timeline for d5kveh_:

  • d5kveh_ is new in SCOPe 2.06-stable
  • d5kveh_ last appears in SCOPe 2.07, called d5kveh1