SCOPe 2.04: Domain d1efca3: 1efc A:8-204

Lineage for d1efca3 (1efc A:8-204)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Escherichia coli [TaxId:562] [52627] (10 PDB entries)
   Uniprot P02990

8. Domain d1efca3: 1efc A:8-204 [32113]
   Other proteins in same PDB: d1efca1, d1efca2, d1efcb1, d1efcb2
   complexed with gdp, mg

Details for d1efca3

PDB Entry: 1efc, 2.05 Å

PDB Description: intact elongation factor from e.coli

PDB Compounds: (A:) protein (elongation factor)

SCOPe Domain Sequences for d1efca3:

Sequence; same for both SEQRES and ATOM records:

>d1efca3 c.37.1.8 (A:8-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

Timeline for d1efca3:

• d1efca3 first appeared (with stable ids) in SCOP 1.55
  
• d1efca3 appears in SCOPe 2.03
  
• d1efca3 appears in SCOPe 2.05
  
• d1efca3 appears in the current release, SCOPe 2.08